PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G074700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 882aa    MW: 96301.5 Da    PI: 6.1921
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G074700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.8e-29534584252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l+kyF++++kdA+k+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Sevir.8G074700.1.p 534 EKNISLSVLQKYFAGSLKDASKSLGVCPTTLKRICRQHGISRWPSRKIKKV 584
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.745519604IPR003035RWP-RK domain
PfamPF020421.8E-25536584IPR003035RWP-RK domain
SuperFamilySSF542774.58E-21778870No hitNo description
SMARTSM006661.1E-18784866IPR000270PB1 domain
PROSITE profilePS5174521.472784866IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.2E-21784866No hitNo description
PfamPF005643.0E-14784865IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 882 aa     Download sequence    Send to blast
MDGIGTSVCG AGSPPDMDSF TLSDFDGLER YTDLGAGISV DDSVLSALCS SLSSEEQAEA  60
GASISEDGDS PDGSASGEVM HMCTATLPKS IHGAAITLPE RMLRALAMLK DASSGSGAIL  120
AQVWMPVRYG ERQVLTTSDQ PFLLDQRLTG YREISRKFIF SASEGPEQFP GLPGRVFISC  180
MPEWTSNVMY YHDSEYLRVD HAARHEVRGS LAVPVIDSSG PSDSCCAVLE VVMTQEKDNF  240
MSEIDSISKA LQSVNLSTVK AWTYPQNLTR NQESAFTEIS DVLQTVCHAH MLPLALVWVP  300
FCSSSNANVS IEYGDQDMKF NLRKKDLLCI HESACYANDM RMHYFVRACG DHPLERGQGV  360
AGNVILSNSP FFSCDVKDYD VCDYPLAHHA RKFGLQAAVA IRLRSTYTGS DDYVLEYFLP  420
LMCKGCDEQQ RLLDDIAETM QRACKSLRTV SNSELMADTT VKPSNKKGCR IRFPSSDMSI  480
NSGHKLNVIS TIKANVLSGH QKMNTNELLG DMKRAKKLKP STTSHGEKTS TSMEKNISLS  540
VLQKYFAGSL KDASKSLGVC PTTLKRICRQ HGISRWPSRK IKKVNRSLEK IQNVISSVHG  600
VVDRELKYDP ATGFLISSIS PSGNPLLIDV EGDGVDPPHI ESESSQLKIK LDCGASQGEY  660
QGQLVLKAQE EKLSEIDFSL NEGRLSLNSH SSGTSNRSLS ADTYNVSHFI NEKATSFQTG  720
LGIVGSQGNN ASRDLFLVPQ SNIGTETLPS SSSKTDYSSG SASSHGTFQK CSKTQASANE  780
GNTTVTVKAN YKDDAVRFKL LPSMKHHDLL EEIAKRMKLS VGSFHLKYRD DEDDWVILES  840
DADLQECLDI LEITRSHVLK VQVRDVTHPA ASSGSSSVLG M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978948.10.0PREDICTED: protein NLP2-like
TrEMBLK3ZHC20.0K3ZHC2_SETIT; Uncharacterized protein
STRINGSi025974m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-174Nin-like family protein